PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 248aa    MW: 28460.8 Da    PI: 7.9735
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009764genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260106.32.5e-3310100191
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                  aCa+C+++r+kC+++C+lapyfp +++k+f++vhklFG+snv+k+l+ l+  +r++a++slv+eA +r++dP+ G++g ++++ ++le  +
  DCAR_009764  10 ACASCRHQRKKCTENCILAPYFPLNKNKEFQAVHKLFGVSNVTKILSGLDVRDRQRAVDSLVWEATCRQNDPILGSFGEFSRVYEELEWYR 100
                  7******************************************************************************999998887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.8859110IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3210100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MQKENGLPAA CASCRHQRKK CTENCILAPY FPLNKNKEFQ AVHKLFGVSN VTKILSGLDV  60
RDRQRAVDSL VWEATCRQND PILGSFGEFS RVYEELEWYR YQFRSNFQTV APENNMSFLD  120
NRGFNTSSNS AFMSLNKNRN SSLYSGYNSY ESFQCTDRLR DELSYNCSSV QNTERFKEDS  180
NNSSVILPQQ YGVQHAENFK EERNNSSMIV PQQYTMSTTF NQPYYQLAGT KCNIIELLLS  240
KHAILSA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.19e-38LOB domain-containing protein 2